PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00043429-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 771aa    MW: 84656.5 Da    PI: 5.8031
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00043429-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.68.9e-164488147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      r rW++eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
  PSME_00043429-RA 44 RERWSEEEHLKFLEALKMYGRA-WRRIEEHIG-TKTAVQIRSHAQKF 88
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.54E-153892IPR009057Homeodomain-like
PROSITE profilePS5129421.0243993IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-84190IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-154291IPR006447Myb domain, plants
SMARTSM007171.0E-124391IPR001005SANT/Myb domain
PfamPF002492.9E-134487IPR001005SANT/Myb domain
CDDcd001672.14E-94689No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 771 aa     Download sequence    Send to blast
MKMSLPSNIL TLSGDSNSNS NSICSSGDEI ATKVRKPYTI SKQRERWSEE EHLKFLEALK  60
MYGRAWRRIE EHIGTKTAVQ IRSHAQKFFS KLVRGSSGKG VSSTERAQDI EIPPPRPKRK  120
PRHPYPRKAA GTAHQGGSPA SKEGDVLPSV VSSVPLLSLG DGPCKRARFD QHNANERISN  180
SNNGQDVKME SPRKNSTPLS LKLFGQTMLV SIEGPNTSST EPDLSNDQED IQEFVLVQQE  240
TSSLKTKAKN QILDDGDEIL HRYSQNSQTT AAVNSVLYSG SVSTADRDCR EKTDSDEQIS  300
SELDTNSSCV TRNQESPSIF SGYPRHVPVQ CVVDGAVSEN VNEVVNVTPL GHSALAMSMP  360
DNTSSLSKAE IINPWPSTFS PVFPWVQMQH GDTAVAVATV AAASAWWSLY GAVPSLLHPR  420
MFSGATVPEN ISSAFKTETV MGTREQNQSN MTEREGETLL RGSPSENYTS TLIEESNDAQ  480
GHEEKQSFQT GEEDQIMIET ELGKERSQCA SNTPSSDDSE IDPYSGTNIH EITRNCVQGF  540
QCNGGGYVPE AEEGSSIDEE EMRYSNNLST KQGGFNRAKT CIQNSRNNSC SRVGGHFNDT  600
WKDVSSEGRI AFRDLFAQEV LPQSFSPGDV KFSKINGSDS FFRDSKQKAS RGIEGELYPR  660
VQGSGIGEEQ TYTGKGHTQS PKSPFVSISK EKVLEDSDGA VSHGLLEASA VNFCKGNKFI  720
ASSFGKSKSG VGFVPYERYE RCSMQASKNG LQLRFQETKN CEDVLRDEKR I
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115121RPKRKPR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC3115210.0KC311521.1 Picea abies CCA1-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM4Q9T90.0M4Q9T9_PICAB; CCA1-like protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.11e-32MYB_related family protein